PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_761_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 244aa    MW: 27301 Da    PI: 8.9971
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_761_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.8e-194085147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd +l ++v+++G+++W++I+r+++ gR++k+c++rw + 
     Neem_761_f_4 40 KGPWSAEEDRILTRLVERYGPRNWSLISRYIN-GRSGKSCRLRWCNQ 85
                     79******************************.***********985 PP

2Myb_DNA-binding54.13.5e-1794136347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
     Neem_761_f_4  94 PFSPSEDETILAAHARFGNR-WATIARLLP-GRTDNAVKNHWNST 136
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.723590IPR017930Myb domain
SuperFamilySSF466891.51E-3138133IPR009057Homeodomain-like
SMARTSM007173.0E-173988IPR001005SANT/Myb domain
PfamPF002493.7E-184085IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-254193IPR009057Homeodomain-like
CDDcd001678.07E-164284No hitNo description
SMARTSM007176.7E-1591139IPR001005SANT/Myb domain
PROSITE profilePS5129420.04492141IPR017930Myb domain
CDDcd001671.04E-1194137No hitNo description
Gene3DG3DSA:1.10.10.608.8E-2394140IPR009057Homeodomain-like
PfamPF002492.4E-1494136IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MEAINRCSSN STSSSDSSSS ESSFSGNRTA RTTQKAERIK GPWSAEEDRI LTRLVERYGP  60
RNWSLISRYI NGRSGKSCRL RWCNQLSPNV EHRPFSPSED ETILAAHARF GNRWATIARL  120
LPGRTDNAVK NHWNSTLKRR AREQQKHQQQ EQQLVESVDN GRNNSIGGFV SGSDHQHHQQ  180
QCMGLEDDAL TALTLGPPGS SSAGVTDKRS ESLPTGFWDV MRDVIAKEVR DFMSSSLPET  240
SGFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-42371411105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006434842.11e-110hypothetical protein CICLE_v10002239mg
RefseqXP_006473375.11e-110PREDICTED: myb protein
TrEMBLA0A067H9B11e-110A0A067H9B1_CITSI; Uncharacterized protein
TrEMBLV4T4G71e-110V4T4G7_9R
STRINGPOPTR_0002s13030.17e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145531122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-59myb domain protein 77